I would like to populat the Listbox collection from a column from a Access database I already created the name of the collection as collections. I can autocomplete/Suggest a Textbox with no issues.[code]
View 2 RepliesI just wanna ask how can i add, delete record in datagrid that is bind in a textbox using ms-access.
how to populate listbox from ms-access database.
Is there a way in which I can populate my listbox with an Access (.mdb) database and search for values in it. Also, can I move selected values back & forth from that listbox to another listbox (or textbox). Is this possible using Visual Studio, VB.Net?
View 6 RepliesI need to populate data (Patient ID and name) from a MS Access Database table (PetientInfo) into a listbox depending on date (Datetimepicker). The listbox item will change upon date changed.
When I select a item from listbox the details of the patient will show to the textboxes.
I am trying to populate a listbox from an access database. It is a scheduling database. First my users pick a room they would like to add an event to, then a date. after the date is selected, id like the listbox to populate with meeting titles corresponding to the date they selected. The code so far looks like this:
[Code]...
I have an accdb named base.accdb in the root folder of the program. Basically I have several tables in my database and I need to show their values in listboxes (essentially allowing menus to be edited by adding/removing items in the table)I can't figure out how to connect the database (according to my friends/classmates), and i can't figure out how to pull the information from the table.
Ultimately, it would be nice if someone could tell me how I can pull out the information into maybe an array? so that if i add 3 items into the table, then it will create 3 variables in the program and put the values from the table into those variables.
I have a class with a collection of objects of type clsCDImage
clsAllCDs:
Imports System.Data.OleDb
Public Class clsImages
Private mAllCDimages As New Collection
[Code].....
Ok, so I`ve been studying a bit of VB lately.. bought a few books and read lot`s of articles and seen hours of instructional videos, and I slightly start to get the hang of a few things.. :) I`ve recently started a fun little project, but I seem to lack a bit of knowledge to reach my goal. I`ll first try to describe my project:
[Cde]...
Here's my code, all it does is display the numbers 1 - 10. I want it to display the numbers from the column Sales, from the table Songs.
Imports System.Data.OleDb
Public Class Form1
Dim con As New OleDb.OleDbConnection
Dim dbCommand As OleDbCommand
Dim strInsert As String
[Code] .....
My Access database has one column named 'Term' and the Table name is 'ATG'. I require to populate my listbox with data in the 'Term' columns. I'm unable to do that using this code. Can anyone tell me what's wrong with this (it displays numbers from 1 to 10 and not the database data)
Imports System.Data.OleDb
Public Class Form1
Dim dbConnection As OleDbConnection
Dim dbCommand As OleDbCommand
[code].....
I made a program in Visual Basic 6.0 and am trying to convert it to vb.net.so i am at the stage where the program needs to load the Access file and populate the listbox according to which radio button i chose.
View 3 RepliesI've given up on my harder stuff and have simplified it to something else. There are no errors that pop up now but the list box doesn't populate! I took the code from a book and there's a data adapter, data connection, and data set on the form already (they're not named in this code though, since the book didn't say to). When the program opens, the list box has a line of text in it and the list box doesn't fill with the right items.
Private Sub EditStock_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load
Try
Dim dsitemlist As New DataSet
Dim itemlistadapter As New OleDbDataAdapter _
("SELECT ItemName FROM Stock", ConnectString)
[Code] .....
And here's what shows in the box.
system.data.dataviewmanagerlistitemtypedescriptor
I've been working on this for three days now and I can't seem to get my listbox to populate. I'm connecting to an sql database. Where am I going wrong? Dim cmd As New SqlCommand("SELECT DISTINCT natureport FROM rates ORDER BY natureport", conn)
[Code]...
Populating a listbox with data from a database
View 2 Repliesi want to populate a listbox from a sql database and foll is the code i encountered error with:
Dim con As SqlConnection
Dim cmd As SqlCommand
Dim lrd As SqlDataReader
[code].....
I have inherited some code from an external contractor that I have to modify. Firstly, he uses a strongly typed dataset to retrieve some data from an SQL database and then uses that data to populate a listbox. I have decided to use a dropdown list (as the user can only ever select one value at a time).This is the code that populates the DropDownList
Private Sub FillUserComputer(ByVal userId As String)
Try
TraceDebug("Begin FillUserComputer"[code]....
This works well for the first two entries in the DropDownList. However, whenever I select one of the other options and click the Send Request button it "jumps back" to the 2nd entry in the list and sends that data instead, completely ignoring the option I selected.I think I have narrowed down the problem to the fact that the DataValue for the second entry in the list is a Null value.
My current code only selects a single item from a specific field. How do I make it populate the listbox with ALL the items in a field?
Try
conn.ConnectionString = "server=; username=; password= database="
conn.Open()
Dim sqlAdapter As New MySqlDataAdapter
[code]....
I am trying to populate one column in an Access table using two check boxes - one for 0, one for 10. How do I make it so that on click or after update, whichever check box is checked populates the cell with the associated number?
View 2 RepliesI have an application in which I have to populate a datagridview from one table from an access database. Here is the code that I use to open and close .mdb file.
Public
sql As
String
[Code]....
... But I don't want to use this way... I want a different way with a dataset or... I don't know.
The question says it all, I can connect/Open a Access DB and I can setup a Treeview but how can I bind them together?
View 1 RepliesI have made DataGridView in the designers and connected an Access database to the datagridvies and the Column headers appear as they should and when I check in preview mode all the fields are correctly populated. However, the DataGrid is not populated in normal mode at all. I have been trying to run the project but nothing is happening. What can I do to populate the field.
View 12 RepliesI would like a listbox which use 2 fields for 1 Column, how do i insert this in a query?
[Code]...
I use this code to populate info from Access DB to txtBox[code]...
View 1 Repliesthis code links to the access database but but I just get only the first row in each combobox...
and I want also cboBox3 depend from cboBox2 depends from cboBox1, how can I do it?
Imports System.Data
Imports System.Data.OleDb
Public Class frm
Dim objConnection As New OleDbConnection("Provider=Microsoft.Jet.OLEDB.4.0;Data Source = DBSOURCEDB.mdb;Jet OLEDB:Database Password=pass;")
[Code]...
I have filled a listbox with a column of information from my sql database
Private Sub GetClients() Dim sqlCom As SqlCommand = New SqlCommand("select emailaddress from register where paymentreceived = 'No'", sqlCon) sqlCon.Open() sqlAdapter = New SqlDataAdapter(sqlCom) sqlAdapter.Fill(sqlDS, "register") dr = sqlCom.ExecuteReader If dr.HasRows Then For Each rec As Common.DbDataRecord In dr alRows.Add(rec) Next ListBox1.DataSource = alRows ListBox1.DisplayMember = "emailaddress" End If sqlCon.Close() End Sub
But now when i try to loop through the rows of the listbox
[Code]...
I'm new to visual basic 2010 ultimate. I want to make a search button to "search" ms access 2007 database for specific data and display the results in datagridview. I also want to display the data to textboxes.
View 1 Repliespopulate a TreeView Nodes Collection.I have a table (Employee) which has an EmployeeId, EmployeeName and ManagerId columns.
View 8 RepliesMy program has an access database with a table called "Contacts". This table stores many values. I have a seperate table that stores surveys. Each contact should have a column for every survey, indicating whether or not the survey has been completed. However, this means I need to add columns to the database while the program is running. I tried the following code, which runs WITHOUT errors, but does not seem to actually add the column.
contactsDataAdapter = New OleDb.OleDbDataAdapter("SELECT * FROM Contacts", frmAdmin.con)
contactsCommandBuilder = New OleDb.OleDbCommandBuilder(contactsDataAdapter)
dtContacts.Clear()
[Code].....
I'm using vb2005express for forms (front-end) and ms access database. I have a form with a master-detail setup. The problem I'm having is that when I set the primary key column to autonumber, I don't get the pk value generated in ms access database into my master datatable in forms when a new record is created. Then I tried setting the AutoIncreament to True in the pk column of the datatable in my dataset (forms). This generates a number in my pk column but its not the number generated in the database (since I think because the pk column is still set to AutoNumber). So I change the field property of my pk to Number in the access database and on my dataset (forms), i still have AutoIncrement to True.
This works okay since what it seems to be doing is getting the max value for the pk column when the datatable is filled upon form load. The problem now is that I normally don't do tableadapter.fill(datatable) at form load since I think there would be a performance issue if record counts around millions. What happens now is that when I create a new record, the pk generated is still 1 which will cause duplicate violation when saving to database. I'm not quite familiar with access features but in oracle, what I do is I create a sequence in database then I create a function that gets the next value of the sequence. Then at form load I set the datatable.column.default_value = get_sequence. How do I do this in ms access?
Ive got my listbox which has a list of values from which I got from a database in microsoft access, like below
Apples
Bannanas
Oranges
[code].....